PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01459.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 170aa    MW: 19788 Da    PI: 7.6257
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01459.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.23.2e-1286134553
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                              +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN  L+++l++  
  Rsa1.0_01459.1_g00003.1  86 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNSVL 134
                              79****************************************9999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-1382146IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5384147IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.36E-1286135No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-1086158No hitNo description
PfamPF001702.2E-1086143IPR004827Basic-leucine zipper domain
CDDcd147022.04E-1787135No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MIPAEISGYF QYLSPENLTT IPAEFNIIDM PSSPTSSSSL NYLNELINNN YSSSSNGQYV  60
MTSNNSTSDE DHHHNHRQSI IILDERKQRR MLSNRESARR SRMRKQRHLD ELWSQVIRLR  120
NENNCLIDKL NSVLETQDNV LKENSKLKEE ASDLRRLVCD LKSNKNNNSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198105RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00262DAPTransfer from AT2G04038Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613647.12e-96PREDICTED: basic leucine zipper 43
SwissprotQ9FMC22e-33BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A0D3AVT92e-96A0A0D3AVT9_BRAOL; Uncharacterized protein
STRINGBra025144.1-P3e-92(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.14e-66basic leucine-zipper 48